Activities | Families | Sequences | Fold types | References | Help
B6db sequences: 4iyo.a

4IYO_A

Description cystathionine gamma-lyase-like protein
Activity 4.4.1.1
Family 4.4.1.1
Evidence IDA - direct assay
Phylum Bacteria
OS Xanthomonas oryzae pv. oryzae
GB 4IYO_A
SQ
MSNRTTHSHDGDRALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSR
THNPTRFAYERCVAALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFE
RVRRRTAGLDFSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGL
LTVVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQN
SIGGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHV
LAKRQMSGFGGIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPV
ARREQLGISDALVRLSVGIEDLGDLRGDLERALVNQN
 
last changed 2014/02/26 10:31

B6db sequences