Activities | Families | Sequences | Fold types | References | Help
B6db sequences: 1b54

1B54

Description Yeast Hypothetical Protein
Activity unclassified
Family uncharacterized.family.prosc
Evidence ISS - similarity
Phylum Fungi
OS Saccharomyces cerevisiae
GB 1B54
SQ
MSTGITYDEDRKTQLIAQYESVREVVNAEAKNVHVNENASKILLLVVSKLKPASDIQILY
DHGVREFGENYVQELIEKAKLLPDDIKWHFIGGLQTNKCKDLAKVPNLYSVETIDSLKKA
KKLNESRAKFQPDCNPILCNVQINTSHEDQKSGLNNEAEIFEVIDFFLSEECKYIKLNGL
MTIGSWNVSHEDSKENRDFATLVEWKKKIDAKFGTSLKLSMGMSADFREAIRQGTAEVRI
GTDIFGARPPKNEARII
 
last changed 2007/09/03 15:55

B6db sequences