Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aah59513

AAH59513

Description Unknown (protein for MGC:73157)
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Metazoa
OS Danio rerio
GB AAH59513
SQ
MASVASATSAPSSHKENGMADSASSFKAADTVIQLAQTHKPKPDPNGLVFGSVFTDHMLT
IKWSLQEGWQKPHIQPFGNLSMHPGCSALHYAIQLFEGMKAYRGPDNKVRLFRPMLNMKR
MLKSAHRACLPSFDCAELMECIKKLVDLDQDWVPHSDSASLYIRPTLLGTEPTLGVKKPS
SALLFVILSPVGSYFSTGAKPVSLWADSKYIRAWRGGTGDCKMGGNYGSSIYAQYEAVDF
GCQQVLWLYGDDHQITEVGTMNLFLYWINEKGEEELATPPLDGIILPGVTRQSILELARQ
WSGFKVSERYLTMSDLRRALEENRVKEMFGSGTACVVSPVGRILYQGENLHIPCEGSFPP
LASRLLKELTDIQYGRTPSDWSCII
 
last changed 2005/03/16 20:05

B6db sequences