Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aak28496

AAK28496

Description 1-aminocyclopropane carboxylate deaminase-like protein
Activity 3.5.99.7
Family 3.5.99.7
Evidence ISS - similarity
Phylum Bacteria
OS Agrobacterium tumefaciens
GB AAK28496
SQ
MVPIWRRKMETAMLEKFERYPLTFGATAIEYLPRLTEALGGDVEIWAKREDCNSGLAMGG
NKLRKLEYIVPDAIASNADTLVSIGGVQSNHTRMVAAVAAKLGMKCRLVQESWVPHEDAV
YDRVGNILMTRLMGADSRIVDDGFDIGIRQSWEDAIQSVIDEGGKPYAIPAGASVHKYGG
LGYVAFAEEVARQEADLGFKFDYIIVCVVTGSTQAGMIVGFAAQDRADRVIGIDASGTPE
QTRSQVRQIVDNTAELVELGRPVREDEIVILNDYAYPAYGVPSNETNEAIRLAARTEAMI
TDPVYEGKSMQGMIDLTRKGFFPKGSKVLYAHLGGAPALNGYSYTYRNG
 
last changed 2005/03/16 20:06

B6db sequences