Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aam72830

AAM72830

Description Branched-chain amino acid aminotransferase (EC 2.6.1.42) (BCAT).
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Chlorobium tepidum
GB AAM72830
SQ
MDNSLKIWMNGELVGWSDAKIHVMSHVVHYGSSTFEGIRCYDTVKGSALLFLDEHVRRLW
ESSKIYRIEIPYSETEIKDAIISTIKANNHKACYVRPLVFRGQGALGVNPHRASIEVAIA
TWEWGTYLGEDVLENGVDVKVSSWHRLAPNTLPSWAKAGGNYMNSQLIKMEALSDGYAEG
LALDHNGYVAEGSGENIFVVRNNIIYTPLAAQSILPGFTRHAVMHIARELGYEVRETPIP
REALYIADEIFLTGTAAEITPVRSVDRIPIGNEHRGPVTEALQHEYLKIVHSGEDPYNWL
TFI
 
last changed 2005/03/16 20:04

B6db sequences