Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aao91867

AAO91867

Description branched-chain amino acid aminotransferase 2
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Bacteria
OS Bacillus cereus
GB AAO91867
SQ
MNEQWIFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKS
ILLEIPYSLDEVTNIVVETIRHNKLSNGYIRLVVSRGAGNLGLDPDSCRKPNVVVIAVPI
SLFPQEYYEIDIPVVTVATRRNRPDVLSPQVKSLNYLNNILVRIVAKLAGVQEALMLNDQ
GYVAEGSGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYV
ADEVFLTGTAAEVIAVTTVDGRTIGLGQTGPHTNRLLEEFRKLVVEDGEKIYEENKVG
 
last changed 2005/03/16 20:06

B6db sequences