Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aao91868

AAO91868

Description branched-chain amino acid aminotransferase 2
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Bacteria
OS Bacillus anthracis
GB AAO91868
SQ
MNEQWIFLNGEFVPKDEAKVSVYDHGYLYGDGVFEGIRVYSGNVFRLREHLVRLYESAKS
IMLEIPYSLDEITNIVVETIRQNKLSNGYIRLVVSRGAGNLGLDPDSCTKPNVVVIAEQL
SLFPQEYYEKGIPVVTVATRRNRPDVLSPQVKSLNYLNNILVRIEAKLAGVQEALMLNDQ
GYVAEGSGDNVFIVKGNKLITPPSSAGALEGITRNAILEIGEKLGYDVREELFTRHDVYV
ADEVFLTGTAAEVIAVTTVDGRTIGLGQTGPHTNRLLEEFRKLVIEDGEKIYEENKVG
 
last changed 2005/03/16 20:05

B6db sequences