Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bac22952

BAC22952

Description molybdenum cofactor sulfurase protein
Activity 2.8.1.7
Family 2.8.1.9
Evidence ISS - similarity
Phylum Metazoa
OS Bombyx mori
GB BAC22952
SQ
MTVLSQIIKPDDMIKITSEFARLGDRCYLDNAGATLYPKSLITSINEDLLKNVYMNPHTD
KNTKDYIEQIRCLILKHFNTDPSTYTLIFTSGTTQALKLVIESFQFMKNEDDDLNCGSFV
YLEDNHTSVVGLRELAVDKDAEVVHIAHEDFLNVINTKAKQTSKYTNGGNCLVAYPAQSN
FNGFKYPLNCIENIKNGCLNNHLKKHLCEINSDWYVLLDAAAYVATSKLDLAKVQPDFVS
LSFYKIFGFPTGLGALLVKKSSENVLSQKRYFGGGTVDALLSNEHYHIKREIFHERFEDG
SLSFLSIISLKQCLDTMYRIIPRIIHDDIMETISYHTFYLAKDLYCQLLDLRHRNGTKAI
KFYLDSDFSDITKQGGVLTFNLVREDGTYIGFSEFQHMADLFNISVRTGCFCNSGSCQRH
LHMSNKDMKDMYNAGHRCGDEVDLINEKPTGAIRISFGYYNTFEDVDKFVNMICRCFVNA
KARKQKRIINHFVETPKIKHYNGNVNKIINEQIYFKNVDDVLINIPPMSTKIILKEICIF
PIKSCGAFKILSGWNIGPKGFEYDREWMIVKDNGVCLTQKQNTRMCMIRPQIDLKQKVMI
LNFPGKTPISIPLENSINEVQKNGSLCHSKVCTDMIKGIDCGDEVADWISEALEVSFLRL
IRQSSNDNRSLKKKKDEDKKLLSLSNQAQYLLINKATVKWLSEKIKDPLFTDDLNHLTDR
FRGNLIIEMEQELLEREWHSVIIGNHEFKVEGQCPRCQMVCIDQQTGEKTVEPLRTIAEQ
FGGKLRFGIYLSYVGTVNKSDDRTLKTYSPIKAILNDDNISR
 
last changed 2014/07/11 16:51

B6db sequences