Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bac96006

BAC96006

Description Branched-chain amino acid aminotransferase (EC 2.6.1.42) (BCAT).
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Vibrio vulnificus
GB BAC96006
SQ
MATKTADYIWFNGKMVPWAEANVHVLTHAMHYGTSVFEGVRCYNTPKGPIVFRHQEHAQR
LKDSAKIYRFPIPYSVEEIMEATRETLRQNKLDNAYIRPLAFVGNVGLGVCPPTDTEMDL
IIAAFPWGSYLGEEALENGVDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGGEARRHGY
AEGIALSVDGYLSEGAGENIFVIKNGVITTPPATAAILPGITRDSIMTLAREMGYEVREA
NIAREALYLADEVFMTGTAAEVVPVRSVDQIQVGAGKRGPITKAVQEAYFGLFNGTTEDK
WGWLDYVYPEKK
 
last changed 2005/03/16 20:05

B6db sequences