Activities | Families | Sequences | Fold types | References | Help
B6db sequences: baf63026.1

BAF63026.1

Description putative protein
Activity 5.1.1.18
Family 5.1.1.18
Evidence IDA - direct assay
Phylum Viridiplantae
OS Hordeum vulgare
GB BAF63026.1
SQ
MGSRDDDGHSTEGQGYAADINSIREARARIAPYVHKTPILSSTSIDAIAGKQLFFKCECF
QKAGAFKIRGASNSIFALDDSQAAKGVVTHSSGNHAAAVALAAKLRGIPAYIVIPKNAPA
CKVENVRRYGGQVIWSDVTMESRESIAKKVQEETGAILIHPFNDKYTISGQGTVCLELLE
QVPEIDTIIVPISGGGLISGVTLAAKAINPSIRILAAEPKGADDSAQSKAAGRIIKLPAT
STIADGLRAFLGDLTWPVVRDLVDDVIVVDDNAIVDAMKMCYETLKVAVEPSGAIGLAAA
LSDEFKQSSAWHESSKIGIIVSGGNVDLRVLWDSLYK
 
last changed 2007/11/12 13:48

B6db sequences