Activities | Families | Sequences | Fold types | References | Help
B6db sequences: cac46983

CAC46983

Description PUTATIVE OMEGA-AMINO ACID--PYRUVATE AMINOTRANSFERASE PROTEIN [Sinorhizobium meliloti]
Activity 2.6.1.18
Family 2.6.1.18
Evidence ISS - similarity
Phylum Bacteria
OS Sinorhizobium meliloti
GB CAC46983
SQ
MSNRLNTTPNDLSAFWMPFTANRQFKKEPRLFVGAKDMYYTTHDGRTVLDGTAGLWCVNA
GHCRPKITEAIREQAGELDYAPAFQLGHPKAFELANRLVDIAPEGMNHVLYTNSGSESVD
TALKVALAYHRAKGNGSRFRLIGRERGYHGVNFGGISVGGIVANRKMFGTLLTGVDHLPH
THLPAKNAFSRGEPEHGADLAAELERIVTLHDASTVAAVIVEPVAGSTGVLIPPKGYLQK
LREICTKHGILLIFDEVITGYGRLGTPFAAQYFDVKPDIITTAKGLTNGVIPMGAVFVTS
EIHDAFMTGPEHLIEFFHGYTYSGNPIASAAALGTLDTYREEGLLTRAAELAPYWEEALH
SLKDCPHVIDIRNIGLIGAVELEPIAGEPTKRAFSAFLKAYEKGLLIRTTGDIIALSPPL
IIEKRQIDELFDKLRDVLKNNI
 
last changed 2010/01/08 13:15

B6db sequences