Activities | Families | Sequences | Fold types | References | Help
B6db sequences: ilve.bacsu

ILVE_BACSU

Description Putative branched-chain amino acid aminotransferase (EC 2.6.1.42)
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Bacillus subtilis
GB ILVE_BACSU
SQ
TKQTIRVELTSTKKPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDPTA
MVYHYGQTVFEGLKAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQLV
AIDKDWIPNAEGTSLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKIAV
ESEFVRAVKGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNIFF
KINGEIVTPMLNGSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAFGT
GTAAVISPVGELIWQDETLSINNGETGEIAKKLYDTITGIQKGAVADEFGWTTEVAALTE
SK
 
last changed 2005/03/16 20:04

B6db sequences