Activities | Families | Sequences | Fold types | References | Help
B6db sequences: ilve.salty

ILVE_SALTY

Description Branched-chain amino acid aminotransferase (EC 2.6.1.42) (Transaminase
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Bacteria
OS Salmonella typhimurium
GB ILVE_SALTY
SQ
TTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQRL
RDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLVFVGDVGMGVNPPPGYTTDVI
IAAFPWGAYLGAEALDQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGYQ
EGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQV
LSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDKW
GWLDPVNS
 
last changed 2005/03/16 20:04

B6db sequences