Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.404807.1

NP_404807.1

Description putative amino acid decarboxylase [Yersinia pestis]
Activity 4.1.1.19
Family 4.1.1.19.2
Evidence ISS - similarity
Phylum Bacteria
OS Yersinia pestis
GB NP_404807.1
SQ
MIDLSSHKKRNVLVVDSNIRDINTANGRAVNELIIALNDINFNVIAAATFEDGAATVISD
SSLCCIFVDWTSGGNDDESHSQAFALLQDIRRRNKSVPVLLMAEHSCINSLSLETMQLVN
EFVWMHEDTSEFIAARAKALIIKYYQQLLPPFTQALFQYTQDNPEYSWAAPGHQGGVAFS
KTAVGREFLDFFGENLFRTDTGIERESLGSLLDHSGPIKESEAYAAQVFGAHASYSMLNG
TSGSNRAIMAAVVGDKQIALCDRNCHKSIEQGLVLSGALPVFFIPTRNRYGIIGPIPKAQ
FQPTAIAQKIEQNPLKSLACDSKPVYAVITNCTYDGMCYNAQQAQDLLAKSVDQIHFDEA
WYAYARFNPLYRERFAMRGDPADHDALGPTIFATQSTHKLLAALSQASYIHVRNGKKPIE
HSRFNESYMLQSTTSPLYAIIAANEVGAAMMEGGQGLALTQEVIDEAVDFRLALARAHDA
FAKQGEWFFKPWNTPEITDSKSGKKLPFSQASREQLTTDPACWVLKPGDPWHGFEQLEED
WCMLDPIKAGIMVPGMGDDGKLSEKGIPAAIVTAFLGQRGIVPSRTTDFMVLCLFSVGVT
KGKWGTLINVLLEFKQHYDSNTPISVCLPDLAKNYPHQYAHKGLKVLCDEMFAYMKISEM
DKLQAEAFSHLPTPVVLPRQAFQDHMAGRCELLPIDKLAGRVSAVGVIPYPPGIPIVMPG
ESFGSHEEPWLRYILSITKWGQHFPGFEKILEGSEQKNGQYFIWVLKQ
 
last changed 2005/03/16 20:05

B6db sequences