Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.000855146

WP_000855146

Description NTD biosynthesis operon protein NtdA
Activity ntda
Family ntda
Evidence ISS - similarity
Phylum Bacteria
OS Bacillus anthracis
GB WP_000855146
SQ
MKTLTTISGHSKDNLALLKCLQGETKEKEFEISNILPNHKMKEKLFRENKLKIDIDIEKD
IFNYSRKNIQKIEFMPVNRLISQDEVEKIIGALKDVLPTGQFTSGPFSKKLEEVIGSYLN
KNFVIATSSGTDALMVSLLSIGIQPGDEVIMPANSFAATENAVLAVGAKPIFVDIDQKSY
CIDPSKIEEAITPKTKCILPVHLYGKQCEMKKNREIADIYQLRVIEDACQAIGSSNLGEY
GDIIVLSFNPYKNFGVCGKAGAIVTNNENLAIRCNQYSYHGFEIDKKNKKVLDFGFNSKI
DNLQAAIGLERIKYLSYNNLKRAYLAQRYIRELKDLEDRELIKLPMMTEDNVWHLFPIRV
ENGRRDELKNKLYQLYNIETDIYYPVLSHKQNTKWLKENDLQNNMFNTEQVHKEILHLPL
HPNMMLEEQNFVLEGLFNVNK
 
last changed 2014/02/21 11:59

B6db sequences