Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.018240226

WP_018240226

Description hypothetical protein
Activity rhizomimosinase
Family rhizomimosinase
Evidence ISS - similarity
Phylum Bacteria
OS Rhizobium sp. BR816
GB WP_018240226
SQ
MMHDLHRAPADAAAETTDFDEILDRSTLSTVKWEMEIDRTGNKSLLGFGTADMDFRSPKP
IATALERTARLGHFGYPYKPNSYYEALIGFYKRHFGWEIKREWIAHNVGIYPSMRPLIDR
LSVEGDAIIYQPPVHFQFRNIVAAAGRVPVANPLVLRNGRYEFDFDQLSHCVSSRTRLLL
LCNPHNPVGRVWSRDELAQLAEFCQQHNIVVVSDEVYCGLLHDGFHFTPFGSVSSDALMN
SVSLLSASKMFNLTGLKHSQVIAANPRLMHEYLEGLKRDTSGYGGSLFGHAATEVAYRDC
DGWLADLMKYVAGNYAFAEAFFKERLPRIRIRPTESTYFMWLDLSDYGMSHQEMLDLFET
RHGLVLNYGEDYGPGGEGHIRLNIGTPKSILVQGIGRMAQALSSQER
 
last changed 2014/03/11 11:35

B6db sequences