Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.019004326

WP_019004326

Description hypothetical protein
Activity 2.6.1.1
Family 2.6.1.1.b
Evidence ISS - similarity
Phylum Bacteria
OS Cohnella laeviribosi
GB WP_019004326
SQ
MNPLAQQLNETIEREQPRYAEMLSGLGKAIYFPKVGILSQSAEAKQKAKTYNATIGIATE
NGKPMHLKVIQDKLSAYDPKDIYEYAPPAGKPELRTVWRDKMLKENPSIAGKTISLPIAT
NALTHGLSIVADLFADAGDAVILPDKNWENYELTFGVRRGAVMVEYPLYDKDNRFNAAGL
RDALLAQKDKGKAIVLLNFPNNPTGYTPGTEECEAIVAAIKDAADAGINVVAVTDDAYFG
LFFEDSVHESLFGRLCGLHERVLPIKVDGATKEEYVWGFRVGFITYGGSSEAALAALEQK
TLGIIRATISSGPHPSQTFVLDALKSPDFEAQKAEKFAIMKRRANKVKQLLDSGKYGAEW
TYYPFNSGYFMCLKLLTADAEAVRQRLLDQYQVGTIALGPTDLRVAFSCIEEPYLEDLFD
RIYQAVLDVKAGAASRT
 
last changed 2014/03/04 12:16

B6db sequences