Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.021459514

WP_021459514

Description Siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Staphylococcus sp. EGD-HP3
GB WP_021459514
SQ
MDEARKNSNDSLLSCIGNTPMIQLKHLFPNHKVYAKLEYMNPGGSMKDRPAKYIIEDGLR
RGVITSDTHLIESTSGNLGIALAMIAKIKGLTLTCVVDPKISETNLKIIKSYGANIDMVS
EPDENGGYLMTRINRVQTLLNETTNAYWINQYANELNWQAHYHGAGTEIVDQIAEPIDYF
IAPVSTTGSIMGMSRKIKEHHPQAQIIAVDAKGSVIFGDTPTNRELPGIGASRVPEILNK
QEIDQVVHVDDYQSTLGCKRLVDKEGIFAGGSTGSIIAAIAEIIDNMDHNKTIVTILPDR
GDRYLDLVYSDDWFNHIKESRGALSR
 
last changed 2014/07/04 14:54

B6db sequences