Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.002307756

XP_002307756

Description hypothetical protein
Activity 4.1.1.18
Family 4.1.1.18.a
Evidence ISS - similarity
Phylum Viridiplantae
OS Populus trichocarpa
GB XP_002307756
SQ
MGSIPKNPHAGVLLGAPGVKGKRVTTISKNGLTEFMLSIISKKQETKEPFYVLDLGEVTA
LMDKWLMTLPMVHPFYAVKCNPDPALLGSLAALGSNFDCASRAEIESVLSLGVSPNRIVY
ANPCKQESHIKYAASVGVNLTTFDSKEELDKIRKWHSKCALLIRIKAPDDSGARCPLGPK
YGALPEEVTPLLQAAQTAQLNVVGVSFHIGSGATRSRAYEGAIASAKSVFEAAVRLGMPG
MKILNIGGGFTAGSQFDEAATTIKSALQAYFPNEPGLTVISEPGRFFAESAFTLATNIIG
KRVRGDLREYWINDGIYGSMNCILYDHATITCTPLACNSNHANLTCKGLRAYSSTVFGPT
CDALDTVLTGHQLPELQINDWLVFPHMGAYTAAAGSSFNGFNTAAILTHLASSNMN
 
last changed 2014/07/11 11:14

B6db sequences