Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.002317481

XP_002317481

Description hypothetical protein
Activity 2.6.1.5
Family 2.6.1.5
Evidence ISS - similarity
Phylum Viridiplantae
OS Populus trichocarpa
GB XP_002317481
SQ
MEDGAVNGYEMDTPKNITIKGILSLLMESIDNNNHSRSVISLGMGDPTAHSCFHTTHVAQ
EAVVDALQSDKFNGYAPTVGLPQTRRAIAEYLSRDLPYKLSSDDVFITSGCTQAIDVALA
MLARPGANILLPRPGFPIYELCAAFRHLEVRHFDLLPEKGWEVDLDAVEALADQNTVALV
IINPGNPCGNVYSYQHLKKIAETAEKLKTLVIADEVYGHLAFGRNPFVPMGVFGSIVPVL
TLGSLSKRWIVPGWRLGWFVTSDPSGMFRNPKVVERIKKYFDILGGPATFIQAAVPGILE
LTDEVFFKRTINILKQSSDICCDRIKEIPCISCPYKPEGSMALMMKLNLSLLEDISDDID
FCFKLAREEFVIILPGTAVGLKNWLRITFAVDPVSLEEALGRVKSFCLRHSKQFERY
 
last changed 2014/03/04 12:27

B6db sequences