Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.006581072

XP_006581072

Description tyrosine aminotransferase isoform X1
Activity 2.6.1.5
Family 2.6.1.5
Evidence ISS - similarity
Phylum Viridiplantae
OS Glycine max
GB XP_006581072
SQ
MESGVVAVNNNINNYESKATSTITIKGILSLLMESIDDENCDGGGSKKRVISLGMGDPTL
TTLFHTPKVVEEAVADALQSRKFHGYAPTAGLLQARIAIAEYLSRDLPYQLSRDDVFITC
GCTQAIDVSVAMLARPGANILLPRPGFPIYELCAAFRGVEVRHYDLLPEKGWEVDLDAVE
ALADQNTVALAIINPGNPCGNVYSYHHLEKIAETAKRVGTIVISDEVYGHLAFGSKPFVP
MGVFGSTVPVLTLGSLSKRWIVPGWRLGWFVTNDPSGTFREPKVVERIKKYFDLLGGPAT
FLQAAVPQIIANTEEIFFEKTIDNLRHTADICCKEIEDIPCIFCPYKPEGSMAMMVKLNL
SLLEDISDDIDFCFKLAKEESVIILPGTAVGLKDWLRITFAADPSALGEGMRRIKSFYQR
HARKL
 
last changed 2014/03/04 12:31

B6db sequences