Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.692090

XP_692090

Description unnamed protein product
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Metazoa
OS Danio rerio
GB XP_692090
SQ
MSKQNGFHVVTPLLESTGMSKLVGSTVYLKMESSQPAGSFKIRGIGYMCQNVRKNSRGVI
CSSGGNAGMA TAYAARKLNLPATIVLPLSTPELVAQKLKDQGATVKAVGKVWDDANAEA
LRLAESEGLTVIHPFNQPLVW KGHSSIVHELKASLPSRPGLIVLSVGGGGLFCGVIEGL
DEVGWGDVPVLCMETKGADCFNVALKAKNLVT LPDITSQAVCLGAKTACQQAFEYGKRP
TVISEVVTDLQALEAVELFLDEERVLVELACGASLAAVYSGVV NRLQDEGRLPKPLGPL
VMIVCGGGSMNMAQLQHLQAVIRK
 
last changed 2014/03/05 15:22

B6db sequences