Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.757951

XP_757951

Description hypothetical protein
Activity 2.6.1.28
Family 2.6.1.28
Evidence ISS - similarity
Phylum Fungi
OS Ustilago maydis 521
GB XP_757951
SQ
MTPSAQVANVDPNPYFGDKVGDLASTSETYPKASRVDPARFLSQVSHDRPASAIRSLFPA
ELIPGMLSLLAGKPNPDTFPFESLSLNLKPEAEAGPTQLNIQGEDLVSALQYGATSGIPK
LVQWITELQVHMHKREAVTPGSKLDGVAGRTPWRVTTGNGSQDLLNKTFDALLNPGDVIL
VESPAYTGILPSLVMIKANIVPVTSDDQGMMSSRLAEILANWETDPQTASLARPKCLYTT
PTGANPAGTTASDERKRQILALARQYDFLVLEDDPYYYLHFEGLDQDAVTRPRCRSYWSL
EEEHRERWGTGRVIRFESFSKILAAGLRLGFATGPNEILDAVDANTAMSNLQPSGLAGVV
AYTLLNYWGIPGFLRHVDNVARYYAKRRDNFEAKANKVLGAAGVAQWVTPVAGMFLWLRL
NLPPTGQGESEGDSFALISDKAKAAGVLAVPGVAFIPDGSKSCYVRTSFSIIAEDDVEEA
FNRLRNVVLDAWKDAGKPMPELA
 
last changed 2009/04/30 13:25

B6db sequences