Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp006629222.

YP006629222

Description biosynthesis operon protein NtdA
Activity ntda
Family ntda
Evidence IDA - direct assay
Phylum Bacteria
OS Bacillus subtilis
GB YP006629222
SQ
MQKQVKISGKSKENMSLLKHLKGDVQGKELVIEDSIVNERWKQVLKEKIDIEHDLFNYQK
NREISKVPFLPVDRLITNDEVEDILNTLTEVLPTGKFTSGPYLEQFEKVLSTYLHKRYVI
ATSSGTDAIMIGLLALGLNPGDEVIMPANSFSATENAVLASGGVPIYVDINPQTFCIDPD
KIEEAITPYTKFILPVHLYGKHSDMQHIRQIANRYKLKVIEDACQGIGLTDLGKYADITT
LSFNPYKNFGVCGKAGAIATDNEELAKKCIQFSYHGFEVNVKNKKVINFGFNSKMDNLQA
AIGLERMKYLSLNNFKRLFLADRYITQLAELQNKGYIELPELSEDHVWHLFPIKVRTEDR
ADIMTKLNEDFGVQTDVYYPILSHMQKTPLVQDKYAGLQLVHTEKAHSQVLHLPLYPSFT
LEEQDRVMEGLFHVIKQEIGV
 
last changed 2014/02/21 11:54

B6db sequences