Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.001978198

YP_001978198

Description serine hydroxymethyltransferase protein
Activity 2.1.2.7
Family 2.1.2.7
Evidence ISS - similarity
Phylum Bacteria
OS Rhizobium etli CIAT 652
GB YP_001978198
SQ
MTNAARVHFNTTVQEADPLVADALASERARQQNQIELIASENIVSRAVLDALGHEITNKT
LEGYPGNRFHGGGQFVDIAEQAAIDRAKQLFNCGYANVQPHSGTQANLAVFFLLLKPGEK
VLSLDLAAGGHLSHGMKANLSGRWFDANNYSVNPQNEVIDLDEMERIAEEIRPKLLITGG
SAYPRELDFERMSKIAKKVGAHFLVDMAHIAGLVAGGVHPSPFPHADIVTCTTTKTLRGP
RGGLILTNNEEWYKKLQAAVFPGVQGSLHSNVLAAKAICLGEALRDDFKLYARQVVANAK
VLAETLADRGVRIVSGGTDTHVILLDLSSKGLLGKQAETLLAKANITSNKNPIPGDSPRP
PEWVGMRLGSSAATTRGLKEEEFRVLGHVIADLIDAETEGRTDEIVGTAGAKIAELTEKF
PVYGH
 
last changed 2009/02/26 19:28

B6db sequences