Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.005842375

YP_005842375

Description multiple substrate aminotransferase
Activity 2.6.1.42
Family 2.6.1.42.b
Evidence ISS - similarity
Phylum Archaea
OS Fervidicoccus fontis Kam940
GB YP_005842375
SQ
MKERSIEKTEALSLKHEKFFSKKALEMKASETRELLKLVENSNVISLAGGMPAPETFPVD
IIGEITQEVIKNHAAQALQYGTTNGFTPLRNAIVEWMKKKYSIQISKDNLIITTGSQQAL
DLIGRVFINPGDVVIAEAPTYLSALQAFEYYKPEFVQIPLDDEGIRIDLLEEKLKELKSQ
GKSVKFVYTISIFQNPAGVTMSEKRRKEILELASQYDFIIIEDNPYGELRYSGSPIRPIK
SWDDDGRVLYLGTLSKVLAPGFRIGWIAGDPRFINKLEIAKQSVDLCTSTFNQVIAWKYI
EGGYLDKQIPKIVEFYKPRRDAMLKALEDFMPEGVKWTKPEGGMFIWVTAPEGIDTKLMF
EKAVAKGVAYVPGEAFYAHREVKNAMRLNFTYVSEEKIREGISRLAETIKEEIKKSKI
 
last changed 2014/04/10 14:30

B6db sequences