Activities | Families | Sequences | Fold types | References | Help
B6db sequences: a6qda0

A6QDA0

Description Probable siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence IDA - direct assay
Phylum Bacteria
OS Staphylococcus aureus
GB A6QDA0
SQ
MIEKSQACHDSLLDSVGQTPMVQLHQLFPKHEVFAKLEYMNPGGSMKDRPAKYIIEHGIK
HGLITENTHLIESTSGNLGIALAMIAKIKGLKLTCVVDPKISPTNLKIIKSYGANVEMVE
EPDAHGGYLMTRIAKVQELLATIDDAYWINQYANELNWQSHYHGAGTEIVETIKQPIDYF
VAPVSTTGSIMGMSRKIKEVHPNAQIVAVDAKGSVIFGDKPINRELPGIGASRVPEILNR
SEINQVIHVDDYQSALGCRKLIDYEGIFAGGSTGSIIAAIEQLITSIEEGATIVTILPDR
GDRYLDLVYSDTWLEKMKSRQGVKSE
 
last changed 2014/07/04 14:39

B6db sequences