Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aab86866.1

AAB86866.1

Description cystathionine gamma-lyase-like protein
Activity 4.4.1.1
Family 4.4.1.1
Evidence ISS - similarity
Phylum Bacteria
OS Stenotrophomonas maltophilia
GB AAB86866.1
SQ
MSNATSQDRALALATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNP
TRFAYERCVASLEGGTRGFAFASGMAASSTVIELLDAGSHVVAMDDIYGGSFRLFERVRR
RTAGLDFSFVDLTDLAAFEAAITSKTKMVWIETPTNPMLKIVDIAAVTAIAKRHGLIVVV
DSTFASPMLQRPLELGADLVLHSATKYLNGHSDMVGGMVVVGDNAELAEQMAFLQNSVGG
VQGPFDSFLALRGLKTLPLRMKAHCANALALAQWLEKHPAVEKVIYPGLASHPQHELAGK
QMAGYGGIVSIVLKGGFEAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASISVARRE
QLGISDALVRLSVGVEELGDLQVDLERALGG
 
last changed 2005/03/16 20:05

B6db sequences