Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aaf07191

AAF07191

Description branched-chain amino acid aminotransferase [Solanum tuberosum]
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Viridiplantae
OS Solanum tuberosum
GB AAF07191
SQ
MESGGALAGLHRNPTFHHLLRPPRTAVNNLLSSSSSTYKRHFSPLPLKFQKQSHFASYSY
NCSINDGSTFQVAYSASATHSLANIDWDNLAFGVMPTDYMYSMKCSQDGNFSKGELQRFG
NIELSPASGILNYGQGLFEGLKAYKRHDGNILLFRPEENALRMKMGAERICMPSPSVEQF
VEAVKATVLANERWIPPPGKGSLYIRPLLMGSGAILGVAPAPEYTFLIYVSPVGNYFKEG
MAPINLVIETEMHRATPGGTGGVKTIGNYAAVLKAQSAAKAKGYSDVLYLDSVNKRYLEE
VPSCNGFIVKGNLIATPAIKGTILPGITRKSIIDVALSQGFQVEERQVSVDELLDADEVF
CTGTAVVVSPVGSITHLGKRVSYGSDGVGRVSKQLYSTLTSLQMGLATDNMNWTVALK
 
last changed 2005/03/16 20:05

B6db sequences