Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aaf34406

AAF34406

Description branched-chain amino acid aminotransferase (EC 2.6.1.42)
Activity 2.6.1.42
Family 2.6.1.42
Evidence IDA - direct assay
Phylum Bacteria
OS Lactococcus lactis
GB AAF34406
SQ
MAINLDWENLGFSYRNLPFRYIARFKDGKWSAGELTGDNQLHISESSPALHYGQQGFEGL
KAYRTKDGSIQLFRPDQNAARLQKTARRLCMAEVSTEMFIDAVKQVVKANKDFVPPYGTG
ATLYLRPLLIGVGDVIGVKPADEYIFKVFAMPVGSYFKGGLAPSKFVISREYDRAAPLGT
GGAKVGGNYAASLQAEVGAKASGYADAIYLDPSTHTKIEEVGAANFFGITADNEFITPLS
PSILPSITKYSLLYLAEHRLGLKAIEGEVYAKDLGKFVEAGACGTAAIISPIGRIDDGED
SYIFHSETEVGPTVKRLYDELVGIQFGDVEAPEGWIVKVD
 
last changed 2005/03/16 20:05

B6db sequences