Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aah56538.1

AAH56538.1

Description Unknown (protein for MGC:66001)
Activity 4.4.1.1
Family 4.4.1.1
Evidence ISS - similarity
Phylum Metazoa
OS Danio rerio
GB AAH56538.1
SQ
MQNDSSAGFLPIYKSFATDAIHVGSEPEQWSSMAVVPPISLSTTFKQHGPGKHAGFEYSR
SGNPTRNCLEKAVAALDGAKYCLAVASGLAATLTITHLFKSGDGILCMNDVYGGTNRYFR
KVASEVGLDISFADLTKLEELKAGLKPNTKMVWIETPTNPTMKVVDIQACADIVHKHNKD
TIVVVDNTFMSAYFQRPLALGADICMYSATKYMNGHSDVVMGLISLSRDDLYERLKFLQN
SLGAVPSPFDCYMCNRGLKTLHLRMKQHFKNALAAAQFLEADPRVDRVIFPGLPSHPQHE
LTKRQCTGCPGMITFYIKGKLEHASTFLSNLKLFALAESLGGYESLAEHPAIMTHASVCE
EERKKLGISDTLIRLSVGLEDEEDIIADLDQALGAAHPKK
 
last changed 2005/03/16 20:04

B6db sequences