Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aah60346

AAH60346

Description unnamed protein product
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Metazoa
OS Xenopus laevis
GB AAH60346
SQ
MDFAEQAPFHIVTPLKESRALSKLAGTEVLMKLENVQPAGSFKIRGIGHYCQKLAKKGCT
RFVCSSGGNAGLAAAYACRGLNLPATIVVPQSTGADIVQKLQDLGADVVIIGKVWDDADA
HAHQLTETPGSVYISPFNHPLVWEGHSSLVCELKASLGSQKPGALVVSVGGGGLLAGLAE
GLKKVGWSDIPIIAMETKGAHCLNAALEAGKPISLPDITSVAKCLGAKTVCDRAFECTRE
HNVISITVDDREAIRAVEMFLDDELIFVEPACGAALAAVYSGHIQRLQQEGILKTPLDPI
VMVVCGGSSISISQLKHFKSQLNMN
 
last changed 2014/03/05 15:23

B6db sequences