Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aak11219

AAK11219

Description aminotransferase-like protein [Oryza sativa]
Activity gaba-t
Family 2.6.1.96
Evidence ISS - similarity
Phylum Viridiplantae
OS Oryza sativa
GB AAK11219
SQ
MTTPHGLLQYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCY
VYDVNGTKYLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKEL
ISMFTAREMGKVFFTNSGSEANDSQVKIVWYYNNALGRPKKKNIISRTQSYHGTTFISAS
LSGLPTLHQDFDLPGRFVLHTDCPHYWRFHLPGETEEEFATRLADNLENLILKQGPETIA
AFIAEPVIGAGGVILPPKTYFEKIQAVVKKYDNLFIVDEVITGFERLGTMFGSDLYNIKP
DLVSLAKALSSAYAPIGAILVSPEISDVIHSHSNKLGTFAHGFTYSGHPVSCAVALEALK
IYRERDIPGHVTHVAQRFQEGIKAFAAGSPIVGETRGVGLLIATEFTDNKSPYELFPFEW
GVGEIFGQECKKRGMMVKVLGNLIAMSPPLIITREEIDKLVSIYGEALKATEERVAELKS
KKN
 
last changed 2014/02/14 11:38

B6db sequences