Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aak52899

AAK52899

Description gamma-aminobutyrate transaminase (subunit precursor)
Activity gaba-t
Family 2.6.1.96
Evidence IDA - direct assay
Phylum Viridiplantae
OS Arabidopsis thaliana
GB AAK52899
SQ
MVVINSLRRLARTTQVHLHSRYATCMSGNSTSRRIFTTEAAPEKKNTVGSKGHDMLAPFT
AGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRLVSAAVEQLNTLP
FYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKLVWYYNNALGRPE
KKKFIARKKSYHGSTLISASLSGLPPLHQNFDLPAPFVLHTDCPHYWRFHLPGETEEEFS
TRLAKNLEDLIIKEGPETIGAFIAEPVMGAGGVIPPPATYFEKVQAVVKKYDILFIADEV
ICAFGRLGTMFGCDKYNIKPDLVTLAKALSSAYMPIGAILMSQEVADVINSHSSKLGVFS
HGFTYSGHPVSCAVAIEALKIYKERNIPEYVAKVAPRFQDGVKAFASGSPIIGETRGTGL
ILGTEFVDNKSPNEPFPPEWGVGAFFGAECQKHGMLVRVAGDGILMSPPLIISPEEIDEL
ISIYGKALKATEEKVKELKAQHKK
 
last changed 2014/02/14 11:34

B6db sequences