Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aal10665

AAL10665

Description aspartate transaminase-like protein
Activity 2.6.1.1
Family 2.6.1.1.b
Evidence IDA - direct assay
Phylum Bacteria
OS Bacillus subtilis
GB AAL10665
SQ
MNDAAKELNRTLSEENPHVLHMLSDLGRELFYPKGVLTQSAEAKAKAGKYNATIGIATSQ
GESMHFSHIQ ETLSAYNPDDIYDYAPPQGKEPLRQEWLKKMRLENPSLAGKDISTPIVT
NALTHGLSIAADLFVNEGDTL LLPDKYWGNYNFIFGVRRKASIETYPLFQQDGRFNAAG
LSELLKKQEEKAIVVLNFPNNPTGYTPGEEEA SEIVSVILEAAEAGKEIVVLVDDAYYN
LFYDETAIQESIFSKLAQVHDRVLCVKIDGATKENYAWGFRVG FITYSTKSEKALRVLE
EKTKGIIRGTISSAPHPSQTFMLRAMQSPEYEKEKSLKYNIMKKRADKVKAVLA ENKHY
EDVWTPYPFNSGYFMCVRLKDINAGELRVSLLEKRGIGTISINETDLRIAFSCVEEEHIA
DLFEE IYQEAKQLQKQAEISG 
 
last changed 2014/03/04 11:55

B6db sequences