Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aao06962

AAO06962

Description Putative branched-chain amino acid aminotransferase
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Viridiplantae
OS Oryza sativa
GB AAO06962
SQ
MAAAAAAASSAKRALLPWARDAHHALARALQGCGGGGGLGLRGALPTAGGRWSLLQCRWR
SSLPQLDSADRSDEESGGEIDWDNLGFGLTPTDYMYVMRCSLEDGVFSRGELSRYGNIEL
SPSSGVINYGQGLFEGLKAYRAANQQGSYMLFRPEENARRMQHGAERMCMPSPSVEQFVH
AVKQTVLANRRWVPPQGKGALYIRPLLIGSGPILGLAPAPEYTFLIYAAPVGTYFKEGLA
PINLVVEDSIHRAMPGGTGGVKTITNYAPVLKAQMDAKSRGFTDVLYLDAVHKTYLEEAS
SCNLFIVKDGVVATPATVGTILPGITRKSVIELARDRGYQVEERLVSIDDLVGADEVFCT
GTAVVVAPVSSVTYHGQRYEFRTGHDTLSQTLHTTLTSIQMGLAEDKKGWTVAID
 
last changed 2005/03/16 20:04

B6db sequences