Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aao92255

AAO92255

Description gamma-aminobutyrate transaminase subunit precursor isozyme 1
Activity gaba-t
Family 2.6.1.96
Evidence ISS - similarity
Phylum Viridiplantae
OS Lycopersicon esculentum
GB AAO92255
SQ
MAKISRLFGSTVKAAITAQAGFHGKRIPAVSSLQEHIVKSTPARYNSTQACLENDISGTD
NKGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSHVYDMQGRKYIDTLAGLWCTALGGNEP
RLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTAKKMAKAFFTNSGSEANDTQV
KLVWYYNNALGRPNKKKFIARAKAYHGSTLISASLTGLPALHQNFDLPAPFVLHTDCPHY
WRYHLPGETEEEFSTRLAKNLEDLILKEGPETIAAFIAEPVMGAGGVIPPPATYFDKIQA
VVKKYDILFIADEVICAFGRLGTMFGSDMYNIKPDLVTLAKALSSAYMPIGAVLVSPEVS
DVIHSQSNKLGSFSHGFTYSGHPVACAVALEAIKIYKERNMVERVNRISPKFQEGLKAFS
DSPIIGEIRGLGLILATEFANNKSPNDHFPPEWGVGAYFGAQCQKNGMLVRVAGDTIMMS
PPFVVTPEELDELIRIYGKALRETEKRVEELKSQK
 
last changed 2014/02/14 11:37

B6db sequences