Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aao92256

AAO92256

Description gamma-aminobutyrate transaminase subunit precursor isozyme 2
Activity gaba-t
Family 2.6.1.96
Evidence ISS - similarity
Phylum Viridiplantae
OS Lycopersicon esculentum
GB AAO92256
SQ
MAKTNGFMGHDMLAPFTAAWMIDMGPLVIDKAEGSYVYGVNGKKYLDSLSGLWCTVLGGS
EPRLIEAASKQLNKSAFYHSFWNRTTKPSLDLAKELINMFTANKMGKVFFTSSGSEANDT
QVKLVWYYNNAIGRPNKKKIISRKNAYHGSTYMTAGLSGLPSLHLKFDLPPPYILHTDCP
HYWNYHLPGETEEEYSTRLANNLENLILKEGPETVAAFIAEPVMGGAGVIIPPATYFEKI
QAVLKKYDILFIADEVICGFGRLGTMFGCDKYNIKPDLVSIAKALSGGYIPIGAVLVSEE
ISKVIMSQSNQLGVFCHGFTYSGHPVACAVALEALKIYKEKNITEVVNKLSPKLQEGLKA
FIDSPIIGEIRGTGLVLSTEFVDNKSPNDPFPPEWGVGTYFGSQCQKHGMLVSFSGDHVN
MAPPFTLSLEELDEMISIYGKALKDTEKRVEELKSQKK
 
last changed 2014/02/14 11:39

B6db sequences