Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aao92257

AAO92257

Description gamma-aminobutyrate transaminase subunit precursor isozyme 3
Activity gaba-t
Family 2.6.1.96
Evidence ISS - similarity
Phylum Viridiplantae
OS Lycopersicon esculentum
GB AAO92257
SQ
MAKITSLIGSGIVAATNQVGPHVKHIPAVGNLQKQIVSDQIQVRWSSTETSLKNDISATD
VRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEP
RLVAAATKQLNELAFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQV
KLVWYYNNALGRPDKKKFIARTKSYHGSTLISASLSGLPALHQQFDLPAPFVLHTDCPHF
WRFHQPGETEEEFSTRLANNLENLILKEGPETIAAFIAEPVMGAGGVIPPPATYFEKVQA
ILKKYDILFIADEVICGFGRLGTMFGCEKYNIKPDLVSVAKALSSGYMPIGAVLVSPEVS
DVIYSQSNKLGTFSHGFTYSGHPVSCAVALETLKIYKERNIIEQVNRISPKFQEGLKAFS
DSPIIGEIRGTGLLHGTEFTDNKSPNDPFPPEWGIGAYFGARCEKHGVLVRVAGDNIMMS
PPYILSLEEIDELIIKYGKALKDTENRVEELKSQKKIKSS
 
last changed 2014/02/14 11:36

B6db sequences