Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aap92672

AAP92672

Description omega-amino acid:pyruvate transaminase
Activity 2.6.1.18
Family 2.6.1.18
Evidence IDA - direct assay
Phylum Bacteria
OS Achromobacter denitrificans
GB AAP92672
SQ
MSAAKLPDLSHLWMPFTANRQFKANPRLLASAKGMYYTSFDGRQILDGTAGLWCVNAGHC
REEIVSAIASQAGVMDYAPGFQLGHPLAFEAATAVAGLMPQGLDRVFFTNSGSESVDTAL
KIALAYHRARGEAQRTRLIGRERGYHGVGFGGISVGGISPNRKTFSGALLPAVDHLPHTH
SLEHNAFTRGQPEWGAHLADELERIIALHDASTIAAVIVEPMAGSTGVLVPPKGYLEKLR
EITARHGILLIFDEVITAYGRLGEATAAAYFGVTPDLITMAKGVSNAAVPAGAVAVRREV
HDAIVNGPQGGIEFFHGYTYSAHPLAAAAVLATLDIYRREDLFARARKLSAAFEEAAHSL
KGAPHVIDVRNIGLVAGIELSPREGAPGARAAEAFQKCFDTGLMVRYTGDILAVSPPLIV
DENQIGQIFEGIGKVLKEVA
 
last changed 2011/04/12 15:11

B6db sequences