Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aaq14479

AAQ14479

Description aminotransferase-like protein [Oryza sativa]
Activity gaba-t
Family 2.6.1.96
Evidence ISS - similarity
Phylum Viridiplantae
OS Oryza sativa
GB AAQ14479
SQ
MVIARGLLRSNASSSSSQAINLLKYVTSTGSLQGHTQNLCDASTRHFSSVPSPQYNSTEE
NGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYLDSLAGLWCTALGGSEPR
LVKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMGKVFFTNSGSEANDSQVK
LVWYYNNALGRPDKKKFIARSKSYHGSTLISASLSGLPALHQKFDLPAPFVLHTDCPHYW
RFHLPGETEEEFATRLANNLEELILKEGPETIAAFIAEPVMGAGGVIPPPKTYFEKVQAI
VKKYDILFIADEVITAFGRLGTMFGSDMYNIKPDLVSMAKALSSAYVPIGAIMVSPEISD
VIHSQSNKLGSFAHGFTYSGHPVACAVAIEALKIYQERNIPDHVKQISPRFQEGVKAFAG
SPIVGEIRGVGLILGTEFADNKSPNDPFPAEWGVGAIFGAECQKRGMLVRVAGDNIMMSP
PLIMTPDEVEELVSIYGDALKATEERVAELKSKKNN
 
last changed 2014/02/14 11:37

B6db sequences