Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aatc2.bovin

AATC2_BOVIN

Description Glutamate oxaloacetate transaminase 1-like protein 1
Activity 5.1.1.13
Family 5.1.1.13.a
Evidence ISS - similarity
Phylum Metazoa
OS Bos taurus
GB AATC2_BOVIN
SQ
MPTLSVFTDVPMAQKLEGSLLKTYKQDDNPNKMFLAYKVCMTSKGRPWVSSVVRKTRMQI
AQDPSLNYEYTPVMGMKSFVQASLNLLFGKNSQVIVENRAGGVQTVGDSGAFQLGAQFLK
SWCQSSQIVYIVSSQKEPHGLIFQDMGFTVYEHTFWDSAHLCLDPNMLLDVVKHAPHGCV
FVIGSMGNCQLTPSQWTQLMTLMKSKEIFPFFDIPYQGLSTGDLEEDARFLHYFVSQGFE
FFCSQSLSKNFGIYDEGVGTLVVVTLDNQLLLRVLSQLMNFARALWLNPPTTGARIITSV
LCNPAMQGEWRQSLEGVVENVMMTKEKVKEKLRLLGTPGSWDHITEQKGSHSYLGLNSQQ
VEYLISEKHIYIPKNGRINFTCINSYNIDYITSSINEAVCFTKDSER
 
last changed 2010/06/14 11:04

B6db sequences