Activities | Families | Sequences | Fold types | References | Help
B6db sequences: aatc2.human

AATC2_HUMAN

Description Glutamate oxaloacetate transaminase 1-like protein 1
Activity 5.1.1.13
Family 5.1.1.13.a
Evidence ISS - similarity
Phylum Metazoa
OS Homo sapiens
GB AATC2_HUMAN
SQ
MPTLSVFMDVPLAHKLEGSLLKTYKQDDYPNKIFLAYRVCMTNEGHPWVSLVVQKTRLQI
SQDPSLNYEYLPTMGLKSFIQASLALLFGKHSQAIVENRVGGVHTVGDSGAFQLGVQFLR
AWHKDARIVYIISSQKELHGLVFQDMGFTVYEYSVWDPKKLCMDPDILLNVVEQIPHGCV
LVMGNIIDCKLTPSGWAKLMSMIKSKQIFPFFDIPCQGLYTSDLEEDTRILQYFVSQGFE
FFCSQSLSKNFGIYDEGVGMLVVVAVNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSI
LCNPALLGEWKQSLKEVVENIMLTKEKVKEKLQLLGTPGSWGHITEQSGTHGYLGLNSQQ
VEYLVRKKHIYIPKNGQINFSCINANNINYITEGINEAVLLTESSEMCLPKEKKTLIGIK
L
 
last changed 2010/06/14 11:02

B6db sequences