Activities | Families | Sequences | Fold types | References | Help
B6db sequences: abb52533

ABB52533

Description 3,4-dehydratase-like protein
Activity vioa
Family vioa
Evidence IDA - direct assay
Phylum Bacteria
OS Streptomyces sp. KCTC 0041BP
GB ABB52533
SQ
MTLKRNVGDLAVFGGPSAFLQPLHVGRPNVGDRARFFDRVNWALDHQWLTNGGPLAREFE
QRVAELAGVRYCVSTCNATVALQLLARAADLSGEVIMPSLTFPATAQAFRWLGLTPVFCD
IDPATSCLDPALVEAAITPRTSAIVPVHLWGRPCAVDQLAKVAADHGIKLFYDAAHGLGC
TAEGQPIGGFGQAEVFSFHATKVVNAFEGGAVVTDDEELAQRVRAMHNFGFAQGRVSTET
GTNGKMTEAAAAMGLTSLDAFEETVRRNEANYDDYRSELAGIAGLKVMEFNRAERNNYHY
LIVEVDAAVTGVHRDLLDGVLRAENVVCQRYFSPGCHEMELYRSERPVTLPHTERLAQRV
LALPTGPTVSREDIRRVCDIVRVTLERGHEVTRRADERVPSTLAP
 
last changed 2009/06/23 11:13

B6db sequences