Activities | Families | Sequences | Fold types | References | Help
B6db sequences: acl17997

ACL17997

Description pyridoxal-5'-phosphate-dependent enzyme
Activity cysteate.synthase
Family 2.5.1.76
Evidence ISS - similarity
Phylum Archaea
OS Candidatus Methanosphaerula palustris
GB ACL17997
SQ
MSGDYQLRCPTCGLRITDRYSSFCPAGHPGLLVTDYPERTLSLSGQPGIFRYESWLPVRG
RLPFTGGTVTYQSDGLAEELGLAHLFIGFNGYWPERGADLVTCSFKELEAVPSMLRATER
TAGILVVASAGNTARAFCQVSALTGIPVVIVVPQSALPRLWTTEPAPAALVIGVDGDYAD
AIAYSTALAAVDPRLIVEGGARNVARRDGMGTVMLDGAVTIGRIPDHYVQAVGSGTGGVA
AYEAASRLIRDGRFGGRLPILHLAQNLPFVPMVAAWEEHTRDLQVGPGTPYTEEAEQWVS
APVLTNRTPPYGVPGGTYDALEATGGEMYAISNGLARAAGTLFTDCEGIDLDPAAAVATA
SLIQAIEMGTIEPGSRVLLNITGGGYDRVVEDHTLVPTPAGYRVPAGNPDDEIRRDVITW
VNDHA
 
last changed 2010/01/12 13:07

B6db sequences