Activities | Families | Sequences | Fold types | References | Help
B6db sequences: acr13272

ACR13272

Description purine catabolism protein PucG
Activity pucg
Family pucg
Evidence ISS - similarity
Phylum Bacteria
OS Teredinibacter turnerae
GB ACR13272
SQ
MSDYLHESFLPPPRLLMGPGPINCDPRVLRAMSYQLVGQFDPAMTRCMTETMALYRGVFK
TKNPWTFIVDSTARGGIEAAMVSLLNPGDKVVVPVFGRFGLLLKEIAERCGALVHTLDLE
WGQVAQPEQIEAAIHRFNPKLVALVQGDTSTTMCQPLADIGPMCFDMGVLTYCDATASLG
GNDFRTDEWKISAVTAGLQKCLSGPSGSAPITLSSQAVDEINKRRHVEAGIKAAHHTEAT
GSRISSNYFDLAMIMDYWGEERLNHHTEATSMLYGARECARILLEEGVDNTVARHKQNGD
ALAAGLRAMGLTLYGEQSQRMNNVVGVYIPEQVNGDRVRQQMLEDFGIEIGTSFGPLHGV
IWRIGTMGYNARRSAVLQTLASLEQCLLLNGLKLPAGAAVRQALSVYQ
 
last changed 2010/06/17 12:52

B6db sequences