Activities | Families | Sequences | Fold types | References | Help
B6db sequences: adc45389

ADC45389

Description aromatic amino acid transaminase
Activity 2.6.1.5
Family 2.6.1.5
Evidence ISS - similarity
Phylum Viridiplantae
OS Cucumis melo
GB ADC45389
SQ
MEIGAVNSEMDTASTISIKGILSLLVQNADENNGRRLISLGMGDPSAYSCFHTTRIAQDA
VVDCLESEKFNGYAPTVGLPQSRRAIAEYLSRDLPYKLTSDDVFITSGCTQAIDVALAML
ARPGANILLPRPGFPIYELCSSFQNLEVRHFNLLPQQGWEVDLHAIETLADKNTVALVII
NPGNPCGNVYSYQHLKKIAETAEKLGILVIADEVYGHLAFGSRPFVPMGVFGSTVPVLTL
GSLSKRWIVPGWRLGWFVTSDPSGMFRKPKVIERIKKYFDTLGGPATFIQAAVPRILEST
DEVFFKKTINILKQTSEICCRKIKEIPCITCTHRPEGSMAMMVRLNIDLLEDISDDIDFC
FKLAKEESLVILPGTAVGLKNWLRITFAVDPSFLEEALGRLKSFCQRHTLML
 
last changed 2014/03/04 12:30

B6db sequences