Activities | Families | Sequences | Fold types | References | Help
B6db sequences: add54646

ADD54646

Description aminotransferase family protein
Activity 2.6.1.5
Family 2.6.1.5
Evidence ISS - similarity
Phylum Viridiplantae
OS Bruguiera gymnorhiza
GB ADD54646
SQ
MEKGITRSHEVETSNTITIKGILSLLMQSIDERVGRSVISLGMGDPSAYSCFHTTPVAQE
AVVDALQCDKFNGYSPTVGLPQTRRAVAEFLSRDLPYKLSADDVFITCGCTQSIDVAVAM
LAHPGANILLPRPGFPIYELSASFRHLEVRHFDLLPEKGWEVDLNAVEALADENTVALVI
INPGNPCGNVYSYQHLKRIAETAEKLKILVIADEVYGHLAFGHNPFIPMGVFGSIVPVLT
LGSLSKRWIVPGWRLGWFVISDPVGTFRKPKTVERIKKYFDLLGGPATFIQAALPRIIEE
TDEEFFKKTIRTLKQASDICYDKIREISCITCPHKPEGSMAVMLNLELLEDICDDSDFCF
KLAKEESVIVLPGTAVGLKNWIRVTFAADPALLEEALERVKIFCQRHASRALGA
 
last changed 2014/03/04 12:34

B6db sequences