Activities | Families | Sequences | Fold types | References | Help
B6db sequences: af184916

AF184916

Description Branched-chain amino acid aminotransferase, cytosolic
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Metazoa
OS Ovis aries
GB AF184916
SQ
MDCNNGCSAEGTGEGGSKEPVETFKAEDLIITRATILKEKPDPSTLVFGTVFTDHMLTVE
WSLELGWEKPRIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFRPNLNMDRMY
RSAMRATLPAFDKKELLECIQQLVKLDEEWVPYSTSASLYIRPTFIGTEPSLGVKKPTKA
LLFVILSPVGPYFSSGSFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVENA
CQQVLWLYGEENQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVMRQSILDLAHKW
GEFKVSERYLTMDDLTTAVEENRVREMFGSGTACVVCPVSTILYKDETIHIPTMENGPKL
ASRILEKLTDIQYGREESDWTITVA
 
last changed 2005/03/16 20:05

B6db sequences