Activities | Families | Sequences | Fold types | References | Help
B6db sequences: bab20032

BAB20032

Description beta-cyanoalanine synthase like protein [Solanum tuberosum]
Activity 4.4.1.9
Family 4.4.1.9
Evidence ISS - similarity
Phylum Viridiplantae
OS Solanum tuberosum
GB BAB20032
SQ
MATLSRFLKKRSLASNRLFSTQLPHTNIKSEVSQLIGKTPMVYLKKVTEGCGAYIAVKQE
MFQPTSSIKDRPALAMINDAEKKGLISPEKTTLIEPTSGNMGISMAFMAAMKGYKMVLTM
PSYTSMERRVTMRAFGADLILTDPTKGMGGTVKKAYELLESTPNAFMLQQFSNPANTQVH
FDTTGPEIWEETLGNVDIFVMGIGSGGTVTGVGLYLKSKNPNVKIYGLEPTESNILNGGK
PGPHHITGNGVGSKPDIVDMDLMEEVLMVSSEDAVNMARELAVKEGLMVGISSGANTVAA
LRLAQKPENKGKLIVTVHASFGERYLSSVLYQDLRKEAENMQPVSVD
 
last changed 2005/03/16 20:05

B6db sequences